DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and psh

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:249 Identity:83/249 - (33%)
Similarity:124/249 - (49%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVGGQDTNITQYPHQISMRY---RGNHRCGGTIYRSNQIISAAHCVNT-LSGPENLTIVAGSSNI 96
            ||||...:...|||..::.|   ..:.||||::..|..:::||||||| .:.|..:.:  |:.||
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRL--GAVNI 206

  Fly    97 WFPTGPQQELEVREIIIHPKYRTLNNDY-DAAILILDGDFEFNDAVQPIELAKER--PDHDTPVT 158
            ..|....|::.:|.:.|||:|  :.|.| |.|||.|:.|....|.::|..|..:.  |..::...
  Fly   207 ENPDHSYQDIVIRSVKIHPQY--VGNKYNDIAILELERDVVETDNIRPACLHTDATDPPSNSKFF 269

  Fly   159 VTGWG----TTSEGGTISDVLQEVSVNVVDNSNCKNAY-----SIMLTSR-----MLCAGVNGGG 209
            |.|||    ||.   ..|.:|....:.:|....|..:|     ||.|..:     :|||......
  Fly   270 VAGWGVLNVTTR---ARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLI 331

  Fly   210 KDACQGDSGGPLVYN-------NTLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            .|||:|||||||::.       .|::|::|.|.|||... ||:|..|...||::
  Fly   332 ADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVT-PGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/246 (33%)
Tryp_SPc 36..259 CDD:238113 83/249 (33%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 83/247 (34%)
Tryp_SPc 144..387 CDD:238113 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.