DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Hayan

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:256 Identity:82/256 - (32%)
Similarity:125/256 - (48%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VHIPKLDGRIVGGQDTNITQYPHQISMRYR----GNHRCGGTIYRSNQIISAAHCVNTLSGPENL 87
            |||  |||..|   |..:  |||..::.|.    ...||||::..|..:::||||||:.....:.
  Fly   383 VHI--LDGERV---DRGV--YPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSF 440

  Fly    88 TIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPD 152
             :..|:.||..|....|::.|.::.|||.|...:..||.|||.|..|.:.:|.::|..|..:|  
  Fly   441 -VRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDR-- 502

  Fly   153 HDTPVT----VTGWGTTS-EGGTISDVLQEVSVNVVDNSNCKNAYSIM----------LTSRMLC 202
            .|.|..    |.|||..: ....:|.:|...::::|....|..:::..          :.:..||
  Fly   503 SDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLC 567

  Fly   203 AGVNGGGKDACQGDSGGPLVY-------NNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |......||||||||||||:.       ..:::|::|.|.||| .|.||:|..|...||::
  Fly   568 AADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCA-TKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 75/245 (31%)
Tryp_SPc 36..259 CDD:238113 76/247 (31%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 81/253 (32%)
Tryp_SPc 385..630 CDD:238113 80/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.