DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG9672

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:121/271 - (44%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFLVL-GVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGT 64
            |...|.:.|:| ..|...|.|            .|||.||:|..:.|.|:|.::...|::.||..
  Fly     1 MKLTLTIGLILVAAGVLEAQP------------QGRIAGGEDAVLGQLPYQAALSIGGSYNCGAV 53

  Fly    65 IYRSNQIISAAHCVNTLSGPEN------LTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNND 123
            |......::|..||.: .|.:.      ..:..||.:::  .|.|  :.|.||.|:|.|.||.. 
  Fly    54 IIGQRYALTALSCVCS-DGKDTPWAAVLFAVTVGSVDLY--NGKQ--IRVEEITINPNYSTLKT- 112

  Fly   124 YDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDV-----LQEVSVNVV 183
             ..|:|.|..:..|::.|..|.|:::.|...:.|.|:|||.|:|    |:|     ||..:..|:
  Fly   113 -GIALLRLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTE----SEVNMHRTLQIGAAEVM 172

  Fly   184 DNSNCKNAYS---IMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGV 245
            ....|..|..   ::...::||.| :|..:..|.||.|||.||...|:|:.:...|......|..
  Fly   173 APRECALANRDELLVADDQVLCLG-HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPER 236

  Fly   246 YCSVPDVLDWL 256
            :.|:....||:
  Fly   237 FISIAANYDWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 67/233 (29%)
Tryp_SPc 36..259 CDD:238113 68/235 (29%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 68/234 (29%)
Tryp_SPc 25..250 CDD:238113 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.