DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG9676

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:257 Identity:88/257 - (34%)
Similarity:132/257 - (51%) Gaps:20/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSN 69
            |:|....||       :.:|:.|    ::.|||||......|:|||||:|.||:|.|||:|...:
  Fly     8 LLVLCAAGV-------LAQNDSV----VEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKD 61

  Fly    70 QIISAAHCV---NTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILIL 131
            .:::|||||   |.::....|.|.|||  :...:|..: :.|..:.:||.|.  :|.:|.|:|.|
  Fly    62 YVVTAAHCVKQGNNVAPANELEIQAGS--LLLSSGGVR-VPVATVTVHPNYN--SNGHDVAVLRL 121

  Fly   132 DGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIML 196
            .....||..:..|:||.|.|.:|..|.::|||..|:.|.||:.|..|.|..:...:|:..|...|
  Fly   122 RNSLTFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQL 186

  Fly   197 TSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            ....:|. ::...|.||.||||||..|...|:|:.|:..|......|..|..|..:.:|:.|
  Fly   187 PETTMCL-LHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 80/222 (36%)
Tryp_SPc 36..259 CDD:238113 81/226 (36%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 80/223 (36%)
Tryp_SPc 28..248 CDD:238113 81/226 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.