DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG33160

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:260 Identity:85/260 - (32%)
Similarity:132/260 - (50%) Gaps:20/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQI 71
            :|||..:|...|  :|.:.:  ..::..||:||..::|.:..:.:.:. .....|||::.:...:
  Fly     9 LFLVQILGFHSA--VYAHPD--SVQIQPRIIGGHVSSIKEEKYLVQVT-TSEELCGGSLVKPRWV 68

  Fly    72 ISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELE-VREIIIHPKY--RTLNNDYDAAILILDG 133
            |:|||||.. ....:..|..|:||   ..||...:. |..|.|.|.:  :|||  .|.|.|.|:.
  Fly    69 ITAAHCVYN-KNKNDFKIYGGASN---QAGPYAVIRTVDYIAIRPDFNRKTLN--MDVAALRLNS 127

  Fly   134 DFEFNDAVQPIELAKERPDHDTPVTVTGWG-TTSEGGTISDVLQEVSVNVVDNSNCKNAYSIM-- 195
            |. ....::.|.||.:.......|.|:||| .|::....::.:..|.|.:...::|.:|:..:  
  Fly   128 DM-IGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHR 191

  Fly   196 LTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            :|..|:|| .....||:|.|||||||||...|.||||:|.||| ...||:|.|||::.||....|
  Fly   192 ITRSMVCA-ARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVV 254

  Fly   261  260
              Fly   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 76/225 (34%)
Tryp_SPc 36..259 CDD:238113 77/228 (34%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 76/225 (34%)
Tryp_SPc 34..253 CDD:238113 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.