DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and ctrb.1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:275 Identity:89/275 - (32%)
Similarity:134/275 - (48%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVFLVLGVGCSL-ADPIYRNEEVHIPKLDG--RIVGGQDTNITQYPHQISMR-YRGNHRCGGTIY 66
            :.|.....||.: |.|         |.:.|  |||.|::.....:|.|:|:: ..|.|.|||::.
Zfish    10 LAFFGAAYGCGIPAIP---------PVVTGYARIVNGEEARPHSWPWQVSLQDSTGFHFCGGSLI 65

  Fly    67 RSNQIISAAHC-VNTLSGPENLTIVAG----SSNIWFPTGPQQELEVREIIIHPKYR--TLNNDY 124
            ..|.:::|||| |.|     :..::.|    |||    ....|.:.|.:.|.||.|.  |:||  
Zfish    66 NENWVVTAAHCNVRT-----SHRVILGEHDRSSN----AEAIQTIAVGKSIKHPNYNSFTINN-- 119

  Fly   125 DAAILILDGDFEFNDAVQPIELAKER---PDHDTPVTVTGWGTTSEGGTISD-VLQEVSVNVVDN 185
            |..::.|....:.|..|.|:.||:..   |.....|| :|||.|......:. :||:.::.::.|
Zfish   120 DILLIKLATPAKINTHVSPVCLAETNDNFPGGMKCVT-SGWGLTRYNAPDTPALLQQAALPLLTN 183

  Fly   186 SNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVY 246
            .:||..:...:|..|:|||.:  |..:|.||||||||..|    ||:||||||:.......|.||
Zfish   184 DDCKRYWGTNITDLMICAGAS--GVSSCMGDSGGPLVCENNRVWTLVGIVSWGSSTCSTSTPAVY 246

  Fly   247 CSVPDVLDWLVETVA 261
            ..|..:..|:.:|:|
Zfish   247 ARVTKLRAWVDQTIA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 79/235 (34%)
Tryp_SPc 36..259 CDD:238113 79/238 (33%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 79/236 (33%)
Tryp_SPc 34..259 CDD:238113 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.