DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG31269

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:274 Identity:87/274 - (31%)
Similarity:121/274 - (44%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFLVLGV------------GCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMR-YR 56
            :|:.::||:            |.|.....|:         |.||:|||.......|:|||:: ..
  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYK---------DQRIIGGQAAEDGFAPYQISLQGIS 59

  Fly    57 GNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLN 121
            |.|.|||.|.....:::|||||.....|. |.:|.|::....|.|   ...::.|.||..|....
  Fly    60 GAHSCGGAIINETFVLTAAHCVENAFIPW-LVVVTGTNKYNQPGG---RYFLKAIHIHCNYDNPE 120

  Fly   122 NDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNS 186
            ...|.|:|.|.....:::..|||.|..........|.:||||:|...||....||.:.:..|.:.
  Fly   121 MHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHR 185

  Fly   187 NCKNAYS---------IMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKY 242
            .||...|         |...||:        |:.||.||||||||.|..|:|:|:||..|| ...
  Fly   186 ECKALLSNDEDCDVGHICTFSRL--------GEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGV 241

  Fly   243 PGVYCSVPDVLDWL 256
            |.|:.||....||:
  Fly   242 PDVHASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 78/229 (34%)
Tryp_SPc 36..259 CDD:238113 79/231 (34%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/230 (34%)
Tryp_SPc 38..258 CDD:238113 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.