DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG32834

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:250 Identity:86/250 - (34%)
Similarity:122/250 - (48%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            ||:||.|.:|...|:|..:...|...|.|.|..|:.||:||.||.:....|  ..|..||..:..
  Fly    26 RIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCVQSYGSIE--VRVGTSSRDYDG 88

  Fly   100 TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGT 164
            ||  ..|||.|||.||:|.....|.:.|:|.|....:.::|:|||.:|::.||..:..||:|||:
  Fly    89 TG--FLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQPISIAEDEPDDGSWCTVSGWGS 151

  Fly   165 TSEG--------GTISDVLQEVSVNVVDNSNC-----------KNAYSIMLTSRMLCAGVNGGGK 210
            ||..        |::.|.||...|:|.:...|           .|..|.:    .||.....|| 
  Fly   152 TSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLWDNGISYL----TLCTHNGAGG- 211

  Fly   211 DACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKES 265
              |..|:|.|||.:..|:||:|.| ||..:  |.||.:||....|:.|...|:::
  Fly   212 --CSYDTGAPLVIDGQLVGILSEG-GCTTK--PDVYANVPWFTGWIAENTEDEDT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 83/238 (35%)
Tryp_SPc 36..259 CDD:238113 83/241 (34%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 83/239 (35%)
Tryp_SPc 27..255 CDD:238113 83/241 (34%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.