DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG32755

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:266 Identity:101/266 - (37%)
Similarity:132/266 - (49%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRG--------NHRCGGTIYR 67
            :|...:.|.|.     |.:||    ||||....|.|.|.|:|:|.|.        .|.|||.:..
  Fly    22 IGQPTATASPF-----VILPK----IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVIS 77

  Fly    68 SNQIISAAHC--VNT-----LSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYR--TLNND 123
            ...:.|||||  :||     ...||...:|||||.|.......||..|:.|:.|..|.  ||.| 
  Fly    78 QRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLEN- 141

  Fly   124 YDAAILILDGDFEF-NDAVQPIELAKERPDHDTPVTVTGWG--TTSEGGTISDVLQEVSVNVVDN 185
             |.|:|.|:|...: :..|:.|.||.:.|:..|...:.|||  |..|.   |..||:..|.:::.
  Fly   142 -DIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEK---SASLQQAPVPILNK 202

  Fly   186 SNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVP 250
            ..|:..|.  |.:..:|||...||.|||||||||||:.:..|.||:|||.|||...|||||.:|.
  Fly   203 ELCQVIYK--LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVS 265

  Fly   251 DVLDWL 256
            ..|.|:
  Fly   266 HFLKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 94/239 (39%)
Tryp_SPc 36..259 CDD:238113 95/241 (39%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 95/244 (39%)
Tryp_SPc 38..273 CDD:238113 95/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.