DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:273 Identity:70/273 - (25%)
Similarity:115/273 - (42%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PIYRNEEVHIPKLDG----------RIVGGQDTNITQYPHQISM---RYRGNHRCGGTIYRSNQI 71
            ||.|:..:...:|.|          :||||.:......|:..|:   |..|:|.||||:.....:
  Rat   172 PIPRSPRLPCLRLAGVRFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFV 236

  Fly    72 ISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREII---IHPKYRTLNNDYDAAILILDG 133
            ::||||:..:|. :.:|:|.|:.::......||:..:.::.   .:|: .|||   |..:|.|: 
  Rat   237 LTAAHCLQDISW-QLVTVVLGAHDLLSSEPEQQKFTITQVFENNYNPE-ETLN---DVLLLQLN- 295

  Fly   134 DFEFNDAVQPIELAKE-----RPDHD------TPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSN 187
                    :|..|.|:     .|..|      |.....|||..........||.|::|.||    
  Rat   296 --------RPASLGKQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVV---- 348

  Fly   188 CKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWG-TGCAREKYPGVYCSVPD 251
                 :.:.....:|..|.......|.|||||||:.|..|.|:.|:. ..||..::|..:..|..
  Rat   349 -----TFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSM 408

  Fly   252 VLDWLVETVADKE 264
            .::|:...:...|
  Rat   409 YVNWIHSVLRSAE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 63/237 (27%)
Tryp_SPc 36..259 CDD:238113 64/240 (27%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.