DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Pamr1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_038960854.1 Gene:Pamr1 / 311252 RGDID:1308745 Length:814 Species:Rattus norvegicus


Alignment Length:290 Identity:73/290 - (25%)
Similarity:108/290 - (37%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEVHIPKLDGRIVGGQDTNITQYPHQISMRYR--------GNHR------CGGTIYRSNQIISAA 75
            |.|..||..|          |::|.|.:: ||        |.|:      |.|.:.....::.||
  Rat   544 ESVASPKTQG----------TRWPWQAAI-YRRTSGVHDGGLHKGAWFLVCSGALVNERTVVVAA 597

  Fly    76 HCVN-----TLSGPENLTIVAG---------SSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDA 126
            |||.     |:....:|.:|.|         ...|       |.|.:..||:||.|..:..|.|.
  Rat   598 HCVTELGKVTIIKTADLKVVLGKFYRDDDRDEKTI-------QNLRISAIILHPNYDPILLDTDI 655

  Fly   127 AILILDGDFEFNDAVQPIELAKER----PDHDTPVTVTGWGTTSE---GGTISDVLQEVSVNVVD 184
            |:|.|......:..||||.||..|    ...::.:||.||...::   .|..:|.|....|.|||
  Rat   656 AVLKLLDKARISTRVQPICLATTRDLSASFEESHITVAGWNILADVRSPGFKNDTLHYGMVKVVD 720

  Fly   185 NSNCKNAYS-----IMLTSRMLCAGVNGGGKD------ACQGDSGGPLVYNNT----------LL 228
            :..|:..:.     :.:|..|.||     .||      .|..::||....:..          |:
  Rat   721 SMLCEEQHEDHGIPVSVTDNMFCA-----NKDPSTPSNICTAETGGIAALSFPGRASSEPRWHLV 780

  Fly   229 GIVSWG--TGCAREKYPGVYCSVPDVLDWL 256
            |:|||.  ..|: ......:..|....||:
  Rat   781 GLVSWSYDKTCS-NSLSTAFTKVLPFKDWI 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 66/277 (24%)
Tryp_SPc 36..259 CDD:238113 68/279 (24%)
Pamr1XP_038960854.1 CUB 222..328 CDD:238001
EGF_CA 333..366 CDD:238011
CCP 374..436 CDD:153056
CCP <502..537 CDD:153056
Tryp_SPc 555..812 CDD:238113 67/269 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.