DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss30

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:256 Identity:93/256 - (36%)
Similarity:131/256 - (51%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRIVGGQDTNITQYPHQISMRY-RGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIW 97
            |:||||||....|:|.|:|:.. ...|.|||::.....:::||||......|....:..|...:.
Mouse    72 GKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLS 136

  Fly    98 FPTGPQQELEVREIIIHPKYRTLN-NDYDAAILILDGDF---EFNDAVQPIELAKERPDHDTPVT 158
            ........:.||.|.:||.|...: :..|.|::.||...   :|.    |:.|    |...||:|
Mouse   137 LLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFT----PVCL----PAAQTPLT 193

  Fly   159 ------VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSI---------MLTSRMLCAGVNGG 208
                  |||||.|.| ..::.||||::|.::|:.:|:..|..         ::.|.|||||...|
Mouse   194 PGTVCWVTGWGATQE-RDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGYVEG 257

  Fly   209 GKDACQGDSGGPLV--YNN--TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKES 265
            .||:||||||||||  .|:  |.:||.|||.||||...||||..||..:||:...:|:..|
Mouse   258 QKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENHS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 88/243 (36%)
Tryp_SPc 36..259 CDD:238113 90/246 (37%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 90/246 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.