DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Klk12

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:267 Identity:81/267 - (30%)
Similarity:127/267 - (47%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNH-RCGGTIY 66
            ::.::.|:..||.|.||    .|:::         .|.:......|.|:.: :.|.: ||||.:.
  Rat     2 KLNILLLLCVVGLSQAD----REKIY---------NGVECVKNSQPWQVGL-FHGKYLRCGGVLV 52

  Fly    67 RSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVRE-------IIIHPKYRTL--NN 122
            ....:::||||    ||  ...:..|..::       .:|::.|       .|.||.|...  |:
  Rat    53 DRKWVLTAAHC----SG--KYMVRLGEHSL-------SKLDLTEQLRLTTFSITHPSYHGAYQNH 104

  Fly   123 DYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSE-GGTISDVLQEVSVNVVDNS 186
            ::|..:|.|:.......||:|:.|............::|||||:: .....|.||.:.:::|.|.
  Rat   105 EHDLRLLRLNRPISLTYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNE 169

  Fly   187 NCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGT--GCAREKYPGVYCSV 249
            .|:..:...:|..||||| ...||||||||||||||....|.|:||||:  .|.::..||||..|
  Rat   170 TCRAVFPGRVTENMLCAG-GEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKV 233

  Fly   250 PDVLDWL 256
            ....||:
  Rat   234 CKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 72/232 (31%)
Tryp_SPc 36..259 CDD:238113 74/234 (32%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.