DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Tmprss11e

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:235 Identity:87/235 - (37%)
Similarity:123/235 - (52%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            |||||......::|.|.|:::.|:||||.|:..:..::|||||..|...|...|...|::    .
  Rat   212 RIVGGTSAEEGEWPWQSSLQWDGSHRCGATLISNTWLVSAAHCFRTHKDPSRWTASFGAT----L 272

  Fly   100 TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPD--HD----TPVT 158
            ..|:....:|.||:|.||...::|||.|::.|.......:||..:.|    ||  |:    ..:.
  Rat   273 QPPKLTTGIRRIIVHEKYNYPSHDYDIALVELSRPVPCTNAVHKVCL----PDANHEFQPGQRMF 333

  Fly   159 VTGWGTTSEGGTISDVLQEVSVNVVDNSNCK--NAYSIMLTSRMLCAGVNGGGKDACQGDSGGPL 221
            |||:|.....|...:.|::|.|:.:|...|.  .:|:..:|.||||||...|.||||||||||||
  Rat   334 VTGFGALRNDGFAQNYLRQVQVDYIDTQTCNRPQSYNGAITPRMLCAGFLKGEKDACQGDSGGPL 398

  Fly   222 VYNNT-----LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |..:.     |.|:||||..|.:...||||..|....||:
  Rat   399 VTPDVRDVWYLAGVVSWGDECGQPNKPGVYTRVTAFRDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/232 (37%)
Tryp_SPc 36..259 CDD:238113 86/234 (37%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 86/234 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.