DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and GZMM

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_005308.2 Gene:GZMM / 3004 HGNCID:4712 Length:257 Species:Homo sapiens


Alignment Length:267 Identity:74/267 - (27%)
Similarity:128/267 - (47%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFL-VLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGT 64
            :|.:||:.| .|.||.|...               :|:||::......|:..|::..|:|.|||.
Human     5 VSSLLVLALGALSVGSSFGT---------------QIIGGREVIPHSRPYMASLQRNGSHLCGGV 54

  Fly    65 IYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYR---TLNNDYDA 126
            :.....:::||||:  ......|.:|.|...:   ..|.....::..|.||:|:   .|.|  |.
Human    55 LVHPKWVLTAAHCL--AQRMAQLRLVLGLHTL---DSPGLTFHIKAAIQHPRYKPVPALEN--DL 112

  Fly   127 AILILDGDFEFNDAVQPIELAKERP--DHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCK 189
            |:|.|||..:.:..::|:.|..:|.  ...|..::.|||.|.:||.:|.||:|:.:.|:|...|.
Human   113 ALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCN 177

  Fly   190 NA--YSIMLTSRMLCAGVNGGGKDACQGDSGGPLV--YNNTLLGIVSWGTGCAREKY-PGVYCSV 249
            |:  ::..|:..|:|...:...:..|:||||||||  ....|..::|:.:....:.: |.|..:|
Human   178 NSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLARVLSFSSRVCTDIFKPPVATAV 242

  Fly   250 PDVLDWL 256
            ...:.|:
Human   243 APYVSWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 65/229 (28%)
Tryp_SPc 36..259 CDD:238113 66/231 (29%)
GZMMNP_005308.2 Tryp_SPc 26..252 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.