DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Elane

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:256 Identity:80/256 - (31%)
Similarity:117/256 - (45%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |.|...||||:......:|..:|::.||.|.||.|:...|.::|||||||..:. :::.:|.|:.
  Rat    27 PALASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHCVNGRNF-QSVQVVLGAH 90

  Fly    95 NIWFPTGPQQELEVREII---IHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERP--DHD 154
            ::......:|...|:.|.   ..|. |.||   |..|:.|:|....|..||..||..:..  .:.
  Rat    91 DLRRREPTRQIFSVQRIFENGFDPS-RLLN---DIVIIQLNGSATINANVQVAELPAQGQGVGNR 151

  Fly   155 TPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGG 219
            ||....|||.......:..||||::|.||.|. |:...::........||:       |.|||||
  Rat   152 TPCVAMGWGRLGTNRPLPSVLQELNVTVVTNL-CRRRVNVCTLVPRRQAGI-------CFGDSGG 208

  Fly   220 PLVYNNTLLGIVSW-GTGCAREKYPGVYCSVPDVLDWLVETV-----------ADKESVGK 268
            |||.||.:.||.|: ..||....||..:..|.:..||:...:           .|:|..|:
  Rat   209 PLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAEFADWINSIIRSHDDRPLTNPKDREREGR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 73/225 (32%)
Tryp_SPc 36..259 CDD:238113 75/228 (33%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 74/226 (33%)
Tryp_SPc 33..249 CDD:238113 75/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.