DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Klk1c8

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:272 Identity:82/272 - (30%)
Similarity:128/272 - (47%) Gaps:28/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRS 68
            :|::||:|.:|.:.|          .|....||:||.:......|.|:::.:....:|||.:...
  Rat     3 LLILFLILSLGWNDA----------APPGQSRIIGGFNCEKNSQPWQVAVYHFNEPQCGGVLIHP 57

  Fly    69 NQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKY---------RTLNNDY 124
            :.:|:||||.:.     |..:..|.:|:.......|...|.:...||.:         |...|||
  Rat    58 SWVITAAHCYSV-----NYQVWLGRNNLLEDEPFAQHRLVSQSFPHPGFNLDIIKNHTRKPGNDY 117

  Fly   125 --DAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGT-TSEGGTISDVLQEVSVNVVDNS 186
              |..:|.|....:..|.|:.|:|..|.|...:....:|||: |.......|.||.|:::::.|.
  Rat   118 SNDLMLLHLKTPADITDGVKVIDLPTEEPKVGSTCLTSGWGSITPLKWEFPDDLQCVNIHLLSNE 182

  Fly   187 NCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGT-GCAREKYPGVYCSVP 250
            .|..||:..:|..|||||...||||.|:|||||||:.:..|.||.|||: .|.....|.||..:.
  Rat   183 KCIKAYNDEVTDVMLCAGEMDGGKDICKGDSGGPLICDGVLQGITSWGSMPCGEPNKPSVYTKLI 247

  Fly   251 DVLDWLVETVAD 262
            ....|:.:.:.:
  Rat   248 KFTSWIKKVMKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 74/232 (32%)
Tryp_SPc 36..259 CDD:238113 74/235 (31%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 74/233 (32%)
Tryp_SPc 25..256 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.