DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Klk1c10

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:271 Identity:84/271 - (30%)
Similarity:124/271 - (45%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSN 69
            |::||.|.:|...|          .|....|||||........|.|:::  ...:.|||.:...:
  Rat     4 LILFLALSLGGIDA----------APPGQSRIVGGYKCEKNSQPWQVAI--INEYLCGGVLIDPS 56

  Fly    70 QIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKY---------RTLNNDY- 124
            .:|:||||.:..     ..::.|.:|::......|...|.:...||.|         |...:|| 
  Rat    57 WVITAAHCYSNY-----YHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGDDYS 116

  Fly   125 -DAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSE-GGTISDVLQEVSVNVVDNSN 187
             |..:|.|....:..|.|:.|:|..|.|...:....:|||:|.. ...:.|.||.|:::::.|..
  Rat   117 NDLMLLHLSEPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLNWELPDDLQCVNIHLLSNEK 181

  Fly   188 CKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWG-TGCAREKYPGVYCSVPD 251
            |..||...:|..|||||...|.||.|:|||||||:.:..|.||.||| ..||....||||..:..
  Rat   182 CIEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLICDGVLQGITSWGNVPCAEPYNPGVYTKLIK 246

  Fly   252 VLDWLVETVAD 262
            ...|:.|.:.:
  Rat   247 FTSWIKEVMKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 75/232 (32%)
Tryp_SPc 36..259 CDD:238113 75/235 (32%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 75/233 (32%)
Tryp_SPc 25..254 CDD:238113 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.