DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Klk7

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:232 Identity:78/232 - (33%)
Similarity:111/232 - (47%) Gaps:17/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            ||:.|.......:|.|:::.......|||.:...:.:::||||     .....|:..||..|  .
  Rat    25 RIIDGYKCKEGSHPWQVALLKGDQLHCGGVLVGESWVLTAAHC-----KMGQYTVHLGSDKI--E 82

  Fly   100 TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP----VTVT 160
            ....|.::......||.|.|..:..|..::.:|...:.:|.||.::|    |||..|    .||:
  Rat    83 DQSAQRIKASRSFRHPGYSTRTHVNDIMLVKMDKPVKMSDKVQKVKL----PDHCEPPGTLCTVS 143

  Fly   161 GWG-TTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYN 224
            ||| |||...|....|....|.::.:..||..|..:|...|||||:.....:.|.||||||||.|
  Rat   144 GWGTTTSPDVTFPSDLMCSDVKLISSQECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCN 208

  Fly   225 NTLLGIVSWGT-GCAREKYPGVYCSVPDVLDWLVETV 260
            :||.|:||||| .|.:...||||..|.....||.:|:
  Rat   209 DTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLEDTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 75/225 (33%)
Tryp_SPc 36..259 CDD:238113 76/228 (33%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 75/225 (33%)
Tryp_SPc 26..244 CDD:238113 76/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.