DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Klk9

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:271 Identity:88/271 - (32%)
Similarity:131/271 - (48%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSN 69
            ||:|.:|...|.               .|.|.||.::......|.|..:.|.....||.|:....
  Rat     7 LVLFSLLAGHCG---------------ADTRAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQ 56

  Fly    70 QIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYR---TLNNDYDAAILI- 130
            .:::||||....     |.:..|..::|...||::.|.|.:...||.:.   :.|:..|..:|| 
  Rat    57 WLLTAAHCRKPY-----LWVRLGEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIR 116

  Fly   131 LDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGG-TISDVLQEVSVNVVDNSNCKNAYSI 194
            |......:.||||:.|::..|...|...::|||:.|... .....||..:::::||..|:.||..
  Rat   117 LPRKVRLSPAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCRWAYPG 181

  Fly   195 MLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGT-GCAREKYPGVYCSVPDVLDWLVE 258
            .::.:|||||:..||:.:||||||||||...||.||||.|: .|:|.:.|.||.||...|||:..
  Rat   182 HISEKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWIEN 246

  Fly   259 TVADKESVGKI 269
            ||.......|:
  Rat   247 TVEKYNHTNKL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/225 (34%)
Tryp_SPc 36..259 CDD:238113 78/228 (34%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 78/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.