DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and F2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_075213.2 Gene:F2 / 29251 RGDID:61996 Length:617 Species:Rattus norvegicus


Alignment Length:296 Identity:94/296 - (31%)
Similarity:137/296 - (46%) Gaps:55/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GVG---CSLADPIYR--------NEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHR---CG 62
            |:|   |.|. |::.        .:|:....:|||||.|.|......|.|: |.:|.:.:   ||
  Rat   326 GLGEADCGLR-PLFEKKSLTDKTEKELLDSYIDGRIVEGWDAEKGIAPWQV-MLFRKSPQELLCG 388

  Fly    63 GTIYRSNQIISAAHCVNTLSGP------EN--LTIVAGSSNIWFPTGPQQELEVREIIIHPKYRT 119
            .::.....:::||||:  |..|      ||  |..:...|...:....::...:.:|.|||:|..
  Rat   389 ASLISDRWVLTAAHCI--LYPPWDKNFTENDLLVRIGKHSRTRYERNVEKISMLEKIYIHPRYNW 451

  Fly   120 LNN-DYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVT---------VTGWGTTSEGGTIS-- 172
            ..| |.|.|:|.|.....|:|.:.|:.|    ||..|..:         |||||...|..|.:  
  Rat   452 RENLDRDIALLKLKKPVPFSDYIHPVCL----PDKQTVTSLLQAGYKGRVTGWGNLRETWTTNIN 512

  Fly   173 ----DVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAG--VNGGGK-DACQGDSGGPLV----YNNT 226
                .|||.|::.:|:...||.:..|.:|..|.|||  ||...: |||:||||||.|    ||:.
  Rat   513 EIQPSVLQVVNLPIVERPVCKASTRIRITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPYNHR 577

  Fly   227 --LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
              .:||||||.||.|....|.|..|..:..|:.:.:
  Rat   578 WYQMGIVSWGEGCDRNGKYGFYTHVFRLKRWMQKVI 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/255 (33%)
Tryp_SPc 36..259 CDD:238113 85/258 (33%)
F2NP_075213.2 GLA 25..89 CDD:214503
KR 107..189 CDD:214527
Kringle 215..292 CDD:278480
Thrombin_light 312..359 CDD:286482 7/33 (21%)
Tryp_SPc 359..608 CDD:214473 85/255 (33%)
Tryp_SPc 360..612 CDD:238113 85/258 (33%)
High affinity receptor-binding region which is also known as the TP508 peptide 547..569 13/21 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.