DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Hpn

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:259 Identity:95/259 - (36%)
Similarity:134/259 - (51%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIV------AGS 93
            |||||||:::.::|.|:|:||.|.|.|||::...:.:::||||.     ||...::      ||:
  Rat   203 RIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHCF-----PERNRVLSRWRVFAGA 262

  Fly    94 SNIWFPTGPQQELEVREIIIHPKYRTL------NNDYDAAILILDGDFEFNDAVQPIEL-AKERP 151
            .....|...|  |.|:.:|.|..|...      .|..|.|::.|.......:.:||:.| |..:.
  Rat   263 VARTSPHAVQ--LGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEYIQPVCLPAAGQA 325

  Fly   152 DHDTPV-TVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNA--YSIMLTSRMLCAGVNGGGKDAC 213
            ..|..| ||||||.|...|..:.||||..|.::.|..|.:.  |...:..:|.|||...||.|||
  Rat   326 LVDGKVCTVTGWGNTQFYGQQAVVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAGYPEGGIDAC 390

  Fly   214 QGDSGGPLVYNN--------TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV--ADKESVG 267
            |||||||.|..:        .|.||||||||||..:.||||..|.|..:|:.:.:  :..|::|
  Rat   391 QGDSGGPFVCEDRISGTSRWRLCGIVSWGTGCALARKPGVYTKVIDFREWIFQAIKASGDETLG 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 92/243 (38%)
Tryp_SPc 36..259 CDD:238113 92/246 (37%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275
Tryp_SPc 204..441 CDD:238113 91/243 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.