DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and F11

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:248 Identity:84/248 - (33%)
Similarity:131/248 - (52%) Gaps:21/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTI 89
            :.|...|:..|:.||..:...::|.|:::.....|.|||:|..:..|::||||.:....|:.|.:
  Rat   377 DNVCTTKIRPRVFGGAASVHGEWPWQVTLHTTQGHLCGGSIIGNRWILTAAHCFSGTETPKTLRV 441

  Fly    90 VAGSSNIWFPTGPQQEL-------EVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELA 147
            ..|..|       |.|:       .|:|:|||.:|.:..:.:|.|:|.|:....:.|..:||.|.
  Rat   442 YGGIVN-------QSEINEDTTFFRVQEMIIHDQYTSAESGFDIALLKLEPAMNYTDFQRPICLP 499

  Fly   148 K--ERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY-SIMLTSRMLCAGVNGGG 209
            .  :|....|...|||||.|.....:...||:..|.:|.|..|:..| ...:|::::|||...||
  Rat   500 SKGDRNVVHTECWVTGWGYTKSRDEVQSTLQKAKVPLVSNEECQTRYRKHKITNKVICAGYKEGG 564

  Fly   210 KDACQGDSGGPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            ||.|:|||||||...:.    |:||.|||.||.:::.||||.:|...:||::|
  Rat   565 KDTCKGDSGGPLSCKHNGVWHLVGITSWGEGCGQKERPGVYTNVAKYVDWILE 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 79/233 (34%)
Tryp_SPc 36..259 CDD:238113 81/237 (34%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..374 CDD:128519
Tryp_SPc 387..615 CDD:214473 80/234 (34%)
Tryp_SPc 388..615 CDD:238113 79/233 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.