DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss38

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:259 Identity:86/259 - (33%)
Similarity:128/259 - (49%) Gaps:19/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RNEEVHI--------PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVN 79
            |...:|:        |.|.|:::||:.|...::|.|:|:.|.|.|.|||:|..:..:::||||..
  Rat    93 REPSLHLFLSSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFA 157

  Fly    80 TLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNN-DYDAAILILDGDFEFNDAVQP 143
            .....:...:..|.:|:.......|..|:.::||||.:...:. ..|.|::.......|:|.|.|
  Rat   158 REKRLQTFDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYVLP 222

  Fly   144 IELAKERPD-HDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSI--MLTSRMLCAGV 205
            |.|.....: .|.....||||..|..|.....|.|..:.::....|:..|.:  .|...|||||.
  Rat   223 ICLPSSNLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCAGD 287

  Fly   206 NGGGKDACQGDSGGPLV--YNNTLL--GIVSWGTGCAREKYPGVYCSVPDVLDWL---VETVAD 262
            ....|:.|:||||.|||  .|.|.|  ||||||.|||:..||||:.:|...|:|:   :||:.|
  Rat   288 IKNMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWIRYNMETIPD 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/227 (34%)
Tryp_SPc 36..259 CDD:238113 78/233 (33%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 78/226 (35%)
Tryp_SPc 116..342 CDD:214473 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.