DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss34

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:248 Identity:81/248 - (32%)
Similarity:126/248 - (50%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVGGQDTNITQYPHQISMRY------RGNHRCGGTIYRSNQIISAAHCVNTLSGPEN-LTIVAGS 93
            ||||...:.:::|.|:|:|:      :..|.|||::.....:::|||||.......: ..:..|.
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQ 97

  Fly    94 SNIWFPTGPQQELEVREIIIHPKYR---TLNNDYDAAILILDGDFEFNDAVQPIEL--AKERPDH 153
            ..::   ...|.::|.:||.|||:.   :.....|.|:|.||.....::.|.|:.|  |.:|...
  Rat    98 LRLY---ENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISS 159

  Fly   154 DTPVTVTGWGTTSEGGTISDV--LQEVSVNVVDNSNCKNAY----SIMLTSR-----MLCAGVNG 207
            .....|.|||.......:...  |:||:|.:|.||:|:..|    |:..|::     |||||:. 
  Rat   160 KKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGME- 223

  Fly   208 GGKDACQGDSGGPLV--YNNT--LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
             |:|:||.|||||||  :|.:  .:|:||||.||....:||||..|...|.|:
  Rat   224 -GRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 80/245 (33%)
Tryp_SPc 36..259 CDD:238113 81/248 (33%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 81/248 (33%)
Tryp_SPc 33..275 CDD:214473 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.