DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss27

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:261 Identity:84/261 - (32%)
Similarity:134/261 - (51%) Gaps:27/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |::..|:|||:|....::|.|:|::..|.|.|||::.....:::||||.:..|......::.|:.
  Rat    32 PRMFNRMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLLGAL 96

  Fly    95 NIWFPTGPQQ-ELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVT 158
            .:..| ||.. .:.|:.:..||:|:.:.:..|.|::.|.....|...:.|:.|    ||......
  Rat    97 KLQQP-GPHALYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVCL----PDPSVVFK 156

  Fly   159 ------VTGWGTTSEGGTISD--VLQEVSVNVVDNSNCKNAYS------IMLTS---RMLCAGVN 206
                  |||||:.||...:.:  :||:::|.::|...|...||      |.|.:   .|||||..
  Rat   157 SGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKDDMLCAGFA 221

  Fly   207 GGGKDACQGDSGGPLV----YNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKESVG 267
            .|.||||:||||||||    .:....|::|||.||||...||||..|.....|:.:.:.:.:..|
  Rat   222 EGKKDACKGDSGGPLVCLVDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWIHQIIPELQFQG 286

  Fly   268 K 268
            :
  Rat   287 R 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 81/241 (34%)
Tryp_SPc 36..259 CDD:238113 81/244 (33%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 81/242 (33%)
Tryp_SPc 39..278 CDD:238113 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.