DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss30

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:260 Identity:99/260 - (38%)
Similarity:139/260 - (53%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRIVGGQDTNITQYPHQISMR-YRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLT---IVAGSS 94
            |:||||||....::|.|:|:| .:..|.|||::.....:::||||   ...|.|.:   :..|..
  Rat    29 GKIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHC---FCRPLNSSFYHVKVGGL 90

  Fly    95 NIWFPTGPQQEL-EVREIIIHPKYRTLNNDY---DAAILILDGDFEFNDAVQPIELAKE-RPDHD 154
            .:.. |.|...| .||.|.::|.|  |..|.   |.|:|.||      ..:||.:.:.. .|...
  Rat    91 TLSL-TEPHSTLVAVRNIFVYPTY--LWEDASSGDIALLRLD------TPLQPSQFSPVCLPQAQ 146

  Fly   155 TPVT------VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSI---------MLTSRMLCAG 204
            .|:|      |||||.|.| ..::.||||::|.::|:.:|:..|.|         ::.|.|||||
  Rat   147 APLTPGTVCWVTGWGATHE-RELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAG 210

  Fly   205 VNGGGKDACQGDSGGPLV--YNNTLL--GIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKES 265
            ...|.||:||||||||||  .|::.:  ||.|||.||||...||||..|||.:||:..|:|:..|
  Rat   211 FVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRTLAENHS 275

  Fly   266  265
              Rat   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 93/247 (38%)
Tryp_SPc 36..259 CDD:238113 95/250 (38%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.