DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and KLK9

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:232 Identity:77/232 - (33%)
Similarity:117/232 - (50%) Gaps:11/232 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIW 97
            |.|.:|.::......|.|..:.:.....||.|:.....:::||||....     |.:..|..::|
Human    20 DTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPY-----LWVRLGEHHLW 79

  Fly    98 FPTGPQQELEVREIIIHPKYR---TLNNDYDAAILI-LDGDFEFNDAVQPIELAKERPDHDTPVT 158
            ...||:|...|.:...||.:.   :.|:..|..:|| |......:.||||:.|::..........
Human    80 KWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCL 144

  Fly   159 VTGWGTTSEGGTISDV-LQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLV 222
            ::|||..|....:..| ||..::::::|..|..||...::..|||||:..||:.:||||||||||
Human   145 ISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLV 209

  Fly   223 YNNTLLGIVSWGT-GCAREKYPGVYCSVPDVLDWLVE 258
            .|.||.|:||.|. .|:|.:.|.||.||...|||:.|
Human   210 CNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 73/225 (32%)
Tryp_SPc 36..259 CDD:238113 75/229 (33%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 75/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.