DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG33226

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:292 Identity:84/292 - (28%)
Similarity:129/292 - (44%) Gaps:47/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFLVL-----GVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHR 60
            |..:||.|::.     .:|..|.||......|.:.:   :|:||.:.:|..:|..:.:..||.|.
  Fly    10 MKWLLVCFILALRSYESLGQDLLDPNCVQTPVGVRE---QILGGHNADIKLHPWMVQILQRGYHF 71

  Fly    61 CGGTIYRSNQIISAAHC---------VNTLSG--PENLTIVAGSSNIWFPTGPQQELEVREIIIH 114
            |||::..|..:::||||         ....||  |..|.    ||....|.||  |::|:.|.:|
  Fly    72 CGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLC----SSQYCSPFGP--EIDVKRIFLH 130

  Fly   115 PKYRTLNNDYDAAILILDGDFEFNDAVQPI--------ELAKERPDHDTPVTVTGWGTTSEGGTI 171
            ..||..:| ||.|:.:|.....:|...:||        :..::..::.....|||||.| |....
  Fly   131 SSYRDYHN-YDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKT-ESQLT 193

  Fly   172 SDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPL--------VYNNTLL 228
            |.:||..|:..:|...|...:...:....:|||  ......|.|||||||        |....|.
  Fly   194 STILQTTSLFHLDRKFCAQIFDRKIGWPHICAG--HSQSSTCTGDSGGPLSAELTFSGVKRTVLF 256

  Fly   229 GIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            ||:|:|....||  ..|:.:|....:|:.:.|
  Fly   257 GIISYGAPNCRE--VTVFTNVLRYSNWIRDIV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 73/246 (30%)
Tryp_SPc 36..259 CDD:238113 74/249 (30%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 74/249 (30%)
Tryp_SPc 47..282 CDD:214473 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.