DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG33458

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:280 Identity:77/280 - (27%)
Similarity:119/280 - (42%) Gaps:35/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSN 69
            |:..|:||.|.||........:..|.|...||.||:|:.:...|....:.......|||::....
  Fly     7 LLALLILGHGISLGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHW 71

  Fly    70 QIISAAHCVNTLSGP------ENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAI 128
            .:::||||....:..      ||........|......|..|..:.:.:|||.|||.:. ||.|:
  Fly    72 FVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHY-YDIAL 135

  Fly   129 LILDGDFEFNDAVQPIELAKERPDHDTPV------TVTGWGTTSEGGTISDVLQEVSVNVVDNSN 187
            ..|:....:.|:::||.|.. .|:....|      .:||||.|: ...:||.||...:..:|...
  Fly   136 AKLNRYVVYTDSIRPICLML-NPNWQVYVDTIRYFIITGWGATN-ASEVSDKLQLTRIPQIDRFT 198

  Fly   188 CKNAYSIMLTSRMLCAGVNGG--GKDACQGDSGGPL------VYNNTL--LGIVSWGTGCAREKY 242
            |:..:..|:....:|||.:..  ||    |||||||      .|....  .||||.    .|:.:
  Fly   199 CRYWFGYMVDRTHICAGESKHYVGK----GDSGGPLGSMVDYKYAKRFFQFGIVSH----LRQPF 255

  Fly   243 PG--VYCSVPDVLDWLVETV 260
            .|  |:.::....:|:..|:
  Fly   256 HGVSVFTNILSYSNWIHRTI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 66/243 (27%)
Tryp_SPc 36..259 CDD:238113 66/246 (27%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 66/244 (27%)
Tryp_SPc 38..274 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.