DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG33462

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:95/253 - (37%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PHQIS-------------MRY----RGNHRCGGTIYRSNQIISAAHCVNTLSGPENL--TIVAGS 93
            ||.||             |.|    :|.| |.||:.....:::|||||     |::|  |:..|.
  Fly    32 PHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCV-----PDDLLITVRLGE 90

  Fly    94 SNIWFPTG--------PQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPI-----E 145
            .|......        |.||..|.....|..|...:...|..:|.|....|:.:.::||     .
  Fly    91 YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASN 155

  Fly   146 LAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGK 210
            ..:|..|..|..|.|.|..|:...| |.||:.::::......|...|...:|...:|||  ....
  Fly   156 RFQEPIDQLTWFTTTVWRETAANAT-SKVLRTMNIDRQPKETCSEIYGWNMTFEQICAG--NTLS 217

  Fly   211 DACQGDSGGPLV---YNN-----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            ..|..|||.|.:   ::|     ..|||.|...|..:..  |:...:....||:...|
  Fly   218 QLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDLLSYADWIKRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 62/246 (25%)
Tryp_SPc 36..259 CDD:238113 64/250 (26%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/234 (26%)
Tryp_SPc 48..269 CDD:214473 59/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.