DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Sp212

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:246 Identity:70/246 - (28%)
Similarity:109/246 - (44%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVGGQDTNITQYPHQISMRYRGNHR-----CGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSN 95
            ||.|.:....||| .:|..|....|     |.|::..|:.:|||||||:.::...   :|.|...
  Fly   277 IVRGNEFPRGQYP-WLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDR---VVVGLGR 337

  Fly    96 IWFPTGPQQELEVREI---IIHPKYRTLN-NDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP 156
            .......:...|:|.:   :.||.|.|.: :|.|.|::.::....|||.:.||.:..........
  Fly   338 YDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVS 402

  Fly   157 VT--VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY-SIMLTSRMLCAGVNGGGKDACQGDSG 218
            .|  :.||| ..|..:.:...:.|...:...:.|.:.: ..|:|.|.|||| |..|...|.||||
  Fly   403 TTGFIAGWG-RDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAG-NRDGSGPCVGDSG 465

  Fly   219 GPLVYNN----TLLGIVSWGT-----GCAREKYPGVYCSVPDVLDWLVETV 260
            |.|:...    .|.||||.|.     .|...:|. :||.:...::|:.|.:
  Fly   466 GGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYV-LYCDLSKHINWISENI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 68/239 (28%)
Tryp_SPc 36..259 CDD:238113 69/243 (28%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 69/243 (28%)
Tryp_SPc 277..511 CDD:214473 68/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.