DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Cma1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_037224.1 Gene:Cma1 / 25627 RGDID:2365 Length:247 Species:Rattus norvegicus


Alignment Length:246 Identity:65/246 - (26%)
Similarity:103/246 - (41%) Gaps:48/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRIVGGQDTNITQYPHQ------ISMRYRGNH--RCGGTIYRSNQIISAAHCVNTLSGPENLTIV 90
            |.|:||.:.    .||.      :.:....|:  .|.|.:.|.|.:::||||..     .::|::
  Rat    20 GEIIGGTEC----IPHSRPYMAYLEIVTSDNYLSACSGFLIRRNFVLTAAHCAG-----RSITVL 75

  Fly    91 AGSSNIWFPTGPQQELEVREIIIHPKY--RTLNND-------------YDAAILILDGDFEFNDA 140
            .|:.|..:.....|:|||.:..|||.|  |.:.:|             .....|.|..:|.|   
  Rat    76 LGAHNKTYKEDTWQKLEVEKQFIHPNYDKRLVLHDIMLLKLKEKAKLTLGVGTLPLSANFNF--- 137

  Fly   141 VQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGV 205
            :.|..:.:          ..|||.|:.....||.||||.:.:.:..:||:..|....|: ||.|.
  Rat   138 IPPGRMCR----------AVGWGRTNVNEPASDTLQEVKMRLQEPQSCKHFTSFQHKSQ-LCVGN 191

  Fly   206 NGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ....::..:|||||||:......||.|:....|  |.|.|:..:.....|:
  Rat   192 PKKMQNVYKGDSGGPLLCAGIAQGIASYVHPNA--KPPAVFTRISHYRPWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 63/242 (26%)
Tryp_SPc 36..259 CDD:238113 64/244 (26%)
Cma1NP_037224.1 Tryp_SPc 21..240 CDD:214473 63/243 (26%)
Tryp_SPc 22..243 CDD:238113 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.