DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Klkb1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:246 Identity:93/246 - (37%)
Similarity:146/246 - (59%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLDGRIVGGQDTNITQYPHQISMRYR---GNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAG 92
            |::.|||||.::::.::|.|:|::.:   .||.|||:|.....|::||||.:.:..|:...|..|
  Rat   386 KINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGG 450

  Fly    93 SSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPV 157
            ..|:...|.......::|:|||.||:.....||.|::.|.....:.:..:||.| ..:.|.:|..
  Rat   451 ILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICL-PSKADTNTIY 514

  Fly   158 T---VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY-SIMLTSRMLCAGVNGGGKDACQGDSG 218
            |   |||||.|.|.|...::||:.::.:|.|..|:..| ..::|.:|:|||...||.|||:||||
  Rat   515 TNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSG 579

  Fly   219 GPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV-ADKE 264
            ||||..::    |:||.|||.||||::.||||..|.:.:||::|.: :.||
  Rat   580 GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKE 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 87/230 (38%)
Tryp_SPc 36..259 CDD:238113 88/233 (38%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 88/231 (38%)
Tryp_SPc 391..621 CDD:238113 87/230 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.