DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:264 Identity:99/264 - (37%)
Similarity:140/264 - (53%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTI 65
            ||.:|::.|   ||.::|.|:   |:      |.:||||........|:|:|:. .|.|.|||::
  Rat     1 MSALLILAL---VGAAVAFPL---ED------DDKIVGGYTCPEHSVPYQVSLN-SGYHFCGGSL 52

  Fly    66 YRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYR--TLNNDYDAAI 128
            .....::|||||..:     .:.:..|..||....|.:|.:...:||.||.|.  ||||  |..:
  Rat    53 INDQWVVSAAHCYKS-----RIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNN--DIML 110

  Fly   129 LILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTT-SEGGTISDVLQEVSVNVVDNSNCKNAY 192
            :.|....:.|..|.|:.|........|...::|||.| |.|....|:||.|...|:..::|:.||
  Rat   111 IKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAY 175

  Fly   193 SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLV 257
            ...:||.|:|.|...||||:||||||||:|.|..|.||||||.|||....||||..|.:.:.|:.
  Rat   176 PGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQ 240

  Fly   258 ETVA 261
            :|:|
  Rat   241 DTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 86/222 (39%)
Tryp_SPc 36..259 CDD:238113 87/225 (39%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 86/223 (39%)
Tryp_SPc 24..242 CDD:238113 87/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.