DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG30098

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:284 Identity:75/284 - (26%)
Similarity:122/284 - (42%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLV-LGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRY--RGNH-RCGGT 64
            :|:.||| |.:|......:..::.:.:.::  |::|||:...|.:     |.|  |.|. .|||:
  Fly     6 VLLTFLVILTLGSYGYSQLLDSKCIALFRI--RVIGGQNARRTPW-----MAYLIRDNRFACGGS 63

  Fly    65 IYRSNQIISAAHC--VNTLSGPENLTIVAGSSNIWFPT-GPQQELEVREIIIHPKYRTLNNDYDA 126
            :.....:::||||  :|     :||.:..|..:....| |..:...|..|..|..|....| :|.
  Fly    64 LIAYRFVLTAAHCTKIN-----DNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRN-HDI 122

  Fly   127 AILILDGDFEFNDAVQPI---------ELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNV 182
            |:|.||....::..::||         .||....:    .|:||||..:....:...|||:|:..
  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQN----FTLTGWGQMAHYYKMPTTLQEMSLRR 183

  Fly   183 VDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPL----------VYNNTLLGIVSWGTG- 236
            |.|..|.      :.|..:|..  ...:.||.|||||||          :|  ...|:.:..|| 
  Fly   184 VRNEYCG------VPSLSICCW--NPVQYACFGDSGGPLGSLVKYGHKTIY--VQFGVTNSVTGN 238

  Fly   237 CAREKYPGVYCSVPDVLDWLVETV 260
            |  :.|.. |..:...:.||.:|:
  Fly   239 C--DGYSS-YLDLMSYMPWLYQTL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 66/245 (27%)
Tryp_SPc 36..259 CDD:238113 67/248 (27%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 66/245 (27%)
Tryp_SPc 37..258 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.