DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Ovch2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_766496.2 Gene:Ovch2 / 244199 MGIID:3045251 Length:609 Species:Mus musculus


Alignment Length:295 Identity:98/295 - (33%)
Similarity:150/295 - (50%) Gaps:45/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFLVLGVGC----------SLADP-----IYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYR 56
            :.|:||:.|          |:.:|     :.:.:..:...|..|||||.......||.|:|::.:
Mouse     8 LILILGMVCLEQGHSETLSSIRNPDCGQSLVKPQPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQK 72

  Fly    57 GNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLN 121
            ..|.|||||..|..:|:||||:...:....|.:.||..::......:|.|.:..|||||::.|..
Mouse    73 QKHICGGTIISSQWVITAAHCMANRNIALTLNVTAGEHDLSQAEPGEQTLAIETIIIHPQFSTRK 137

  Fly   122 -NDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP---VTVTGWGTTSEGGTISDVLQEVSVNV 182
             ..||.|:|.:.|.|:|...|:|:.| .|..:|...   .|..|||..||||.:..|||:|::.:
Mouse   138 PMIYDIALLKMAGTFQFGQFVRPVCL-PEPGEHFNAGFICTTAGWGRLSEGGRLPQVLQQVNLPI 201

  Fly   183 VDNSNCKNAYSIMLTSR-------MLCAGVNGGGKDACQGDSGGPLVYNN-----TLLGIVSWGT 235
            :....|:   :::||.:       .||.|...||:|||||||||.|:..|     ||.|:.|||.
Mouse   202 LTQEECE---AVLLTLKNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQNRKGAWTLAGVTSWGL 263

  Fly   236 GC-------AREK---YPGVYCSVPDVLDWLVETV 260
            ||       ||:|   .||::..:..||.|:::.:
Mouse   264 GCGRSWRNNARKKEQGSPGIFTDLRRVLPWILKHI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 90/245 (37%)
Tryp_SPc 36..259 CDD:238113 90/248 (36%)
Ovch2NP_766496.2 Tryp_SPc 51..294 CDD:214473 90/246 (37%)
Tryp_SPc 52..297 CDD:238113 90/248 (36%)
CUB 317..420 CDD:238001
CUB 431..542 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.