DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Klk7

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:235 Identity:80/235 - (34%)
Similarity:118/235 - (50%) Gaps:23/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNH-RCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWF 98
            ||:.|.......:|.|::: .:||. .|||.:.....:::||||   ..|...:.:  ||..|  
Mouse    25 RIIDGYKCKEGSHPWQVAL-LKGNQLHCGGVLVDKYWVLTAAHC---KMGQYQVQL--GSDKI-- 81

  Fly    99 PTGPQ--QELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDH----DTPV 157
              |.|  |:::..:...||.|.|..:..|..::.||...:.:..|:.::|    |:|    .|..
Mouse    82 --GDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQL----PEHCEPPGTSC 140

  Fly   158 TVTGWG-TTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPL 221
            ||:||| |||...|....|....|.::.:..||..|..:|...|||||:.....:.|.|||||||
Mouse   141 TVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPL 205

  Fly   222 VYNNTLLGIVSWGT-GCAREKYPGVYCSVPDVLDWLVETV 260
            |.|:||.|:||||| .|.:...||||..|.....|::||:
Mouse   206 VCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/228 (34%)
Tryp_SPc 36..259 CDD:238113 77/231 (33%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 77/229 (34%)
Serine protease. /evidence=ECO:0000250 26..246 79/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.