DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and TPSD1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:240 Identity:74/240 - (30%)
Similarity:110/240 - (45%) Gaps:37/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVFLVLGVGCSLADPIYRNEEVHIPKLDGR------IVGGQDTNITQYPHQISMRYRG---NHRC 61
            ::.|.|.|   ||.|.|      :....|:      |||||:...:::|.|:|:|.||   .|.|
Human    11 LLLLALPV---LASPAY------VAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFC 66

  Fly    62 GGTIYRSNQIISAAHCVN-TLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYD 125
            ||::.....:::|||||. .:.....|.:.....::::   ..|.|.|..||:||::..:....|
Human    67 GGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYY---QDQLLPVSRIIVHPQFYIIQTGAD 128

  Fly   126 AAILILDGDFEFNDAVQPIEL--AKERPDHDTPVTVTGWGTTSEGGTISD--VLQEVSVNVVDNS 186
            .|:|.|:.....:..:..:.|  |.|......|..|||||.......:..  .|:||.|.||:|.
Human   129 IALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENH 193

  Fly   187 NCKNAYSI---------MLTSRMLCAGVNGGGKDACQGDSGGPLV 222
            .|...|..         ::...|||||  ....|:||||||||||
Human   194 LCNAEYHTGLHTGHSFQIVRDDMLCAG--SENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 66/211 (31%)
Tryp_SPc 36..259 CDD:238113 66/204 (32%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 66/204 (32%)
Tryp_SPc 38..240 CDD:214473 66/204 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.