DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Try4

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:259 Identity:93/259 - (35%)
Similarity:136/259 - (52%) Gaps:21/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQ 70
            ::||.| ||.::|.|:         ..|.:||||........|:|:|:. .|.|.|||::.....
Mouse     4 LLFLAL-VGAAVAFPV---------DDDDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQW 57

  Fly    71 IISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKY--RTLNNDYDAAILILDG 133
            ::|||||..:     .:.:..|..||....|.:|.:...:||.||.:  |||||  |..::.|..
Mouse    58 VVSAAHCYKS-----RIQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNN--DIMLIKLAS 115

  Fly   134 DFEFNDAVQPIELAKERPDHDTPVTVTGWGTT-SEGGTISDVLQEVSVNVVDNSNCKNAYSIMLT 197
            ....|..|..:.|........|...::|||.| |.|....|:||.:...::..::|:.:|...:|
Mouse   116 PVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPGKIT 180

  Fly   198 SRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            :.|:|.|...||||:||||||||:|.|..|.||||||.|||.:..||||..|.:.:||:..|:|
Mouse   181 NNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQNTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 81/222 (36%)
Tryp_SPc 36..259 CDD:238113 83/225 (37%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 82/223 (37%)
Tryp_SPc 24..242 CDD:238113 83/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.