DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss38

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:239 Identity:85/239 - (35%)
Similarity:121/239 - (50%) Gaps:16/239 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |.|.|:::||:.....::|.|:|:.|.|.|.|||:|..:..::|||||.:.....|...|..|.:
Mouse    50 PVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGIT 114

  Fly    95 NIWFPTGPQQELEVREIIIHPKYRTLNN-DYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVT 158
            |:.......|..|:.::||||.::..:. ..|.|::.|.....|:|.|.||.|    |..|..:.
Mouse   115 NLEKANRHTQWFEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSDFVLPICL----PPSDLYLI 175

  Fly   159 -----VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY--SIMLTSRMLCAGVNGGGKDACQGD 216
                 .||||..|..|...:.|.|..:.::....|:..|  |..|...||||......|:.|:||
Mouse   176 NLSCWTTGWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGD 240

  Fly   217 SGGPLV--YNNTLL--GIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ||.|||  .|.|.|  ||||||.|||:..||||:.:|...|.|:
Mouse   241 SGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 81/231 (35%)
Tryp_SPc 36..259 CDD:238113 82/233 (35%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 82/231 (35%)
Tryp_SPc 58..284 CDD:214473 81/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.