DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and F12

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_000496.2 Gene:F12 / 2161 HGNCID:3530 Length:615 Species:Homo sapiens


Alignment Length:241 Identity:86/241 - (35%)
Similarity:117/241 - (48%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            |:|||.......:|: |:..|.|:..|.|::.....:::||||:.....||:||:|.|.......
Human   372 RVVGGLVALRGAHPY-IAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHS 435

  Fly   100 TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDA-----VQPIEL--AKERPDHDTPV 157
            ..|.|.|.||...:|..:..::..:|.|:|.|..|.:.:.|     |||:.|  ...||...|..
Human   436 CEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLC 500

  Fly   158 TVTGWGTTSEGG-TISDVLQEVSVNVVDNSNCK--NAYSIMLTSRMLCAGVNGGGKDACQGDSGG 219
            .|.|||...||. ..:..|||..|..:....|.  :.:...:...|||||...||.|||||||||
Human   501 QVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGG 565

  Fly   220 PLVYNN-------TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            |||..:       ||.||:|||:||.....||||..|...|.|:.|
Human   566 PLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIRE 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/236 (36%)
Tryp_SPc 36..259 CDD:238113 85/240 (35%)
F12NP_000496.2 FN2 41..88 CDD:128373
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
Kringle 217..295 CDD:278480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359
Tryp_SPc 372..609 CDD:214473 84/237 (35%)
Tryp_SPc 373..612 CDD:238113 85/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.