DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and F11

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:246 Identity:89/246 - (36%)
Similarity:135/246 - (54%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLDGRIVGGQDTNITQYPHQISMRYRG---NHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAG 92
            |:..|||||..:...::|.|:::....   .|.|||:|..:..|::||||...:..|:.|.:.:|
Human   384 KIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSG 448

  Fly    93 SSNIWFPTGPQQELE-------VREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKER 150
            ..|       |.|::       |:|||||.:|:...:.||.|:|.|:....:.|:.:||.| ..:
Human   449 ILN-------QSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPICL-PSK 505

  Fly   151 PDHD---TPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY-SIMLTSRMLCAGVNGGGKD 211
            .|.:   |...|||||.......|.:.||:..:.:|.|..|:..| ...:|.:|:|||...||||
Human   506 GDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGGKD 570

  Fly   212 ACQGDSGGPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            ||:|||||||...:.    |:||.|||.|||:.:.||||.:|.:.:||::|
Human   571 ACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILE 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/237 (36%)
Tryp_SPc 36..259 CDD:238113 87/241 (36%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519
Tryp_SPc 388..619 CDD:214473 86/238 (36%)
Tryp_SPc 389..619 CDD:238113 85/237 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.