DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Tmprss4

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:271 Identity:102/271 - (37%)
Similarity:143/271 - (52%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTI 65
            :|..||....|..|.||..|              |:|||.:..:..:|.|:|::|...|.|||:|
Mouse   182 LSGSLVSLRCLDCGKSLKTP--------------RVVGGVEAPVDSWPWQVSIQYNKQHVCGGSI 232

  Fly    66 YRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIII---HPKYRTLNNDYDAA 127
            ...:.|::||||........:..:.|||:.:    |....|.|.:|.|   :|.|   ..:.|.|
Mouse   233 LDPHWILTAAHCFRKYLDVSSWKVRAGSNIL----GNSPSLPVAKIFIAEPNPLY---PKEKDIA 290

  Fly   128 ILILDGDFEFNDAVQPIELAKERPDHD------TPVTVTGWGTTSE-GGTISDVLQEVSVNVVDN 185
            ::.|.....|:.:|:||.|    |..|      |||.|.|||.|.| ||.:||:|.:.||.|:|:
Mouse   291 LVKLQMPLTFSGSVRPICL----PFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDS 351

  Fly   186 SNC--KNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNN---TLLGIVSWGTGCAREKYPGV 245
            :.|  ::||...:|:.|||||...||||.|||||||||:|::   .::||||||.||.....|||
Mouse   352 TRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGV 416

  Fly   246 YCSVPDVLDWL 256
            |..|...|:|:
Mouse   417 YTKVTAYLNWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 93/234 (40%)
Tryp_SPc 36..259 CDD:238113 93/236 (39%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335 4/12 (33%)
Tryp_SPc 202..427 CDD:214473 93/235 (40%)
Tryp_SPc 203..430 CDD:238113 93/236 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H80930
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.