DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss27

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:261 Identity:83/261 - (31%)
Similarity:136/261 - (52%) Gaps:27/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            ||:..|:|||::....::|.|:|::..|.|.|||::.....:::||||.:..|......::.|:.
Mouse    32 PKMFNRMVGGENALEGEWPWQVSIQRNGIHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLLGAL 96

  Fly    95 NIWFPTGPQQ-ELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDT--- 155
            .:..| ||.. .:.|:::..:|:|:.:.:..|.|::.|.|...|.:.:.|:.|    ||...   
Mouse    97 KLQQP-GPHALYVPVKQVKSNPQYQGMASSADVALVELQGPVTFTNYILPVCL----PDPSVIFE 156

  Fly   156 ---PVTVTGWGTTSEGGTISD--VLQEVSVNVVDNSNCKNAYSIMLTS---------RMLCAGVN 206
               ...|||||:.||...:.:  |||:::|.::|...|...|:..:.|         .|||||..
Mouse   157 SGMNCWVTGWGSPSEQDRLPNPRVLQKLAVPIIDTPKCNLLYNKDVESDFQLKTIKDDMLCAGFA 221

  Fly   207 GGGKDACQGDSGGPLV----YNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKESVG 267
            .|.||||:||||||||    .:....|::|||.||||...||||..|.....|:.:.:.:.:..|
Mouse   222 EGKKDACKGDSGGPLVCLVDQSWVQAGVISWGEGCARRNRPGVYIRVTSHHKWIHQIIPELQFQG 286

  Fly   268 K 268
            :
Mouse   287 R 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 79/241 (33%)
Tryp_SPc 36..259 CDD:238113 79/244 (32%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 79/242 (33%)
Tryp_SPc 39..278 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.