DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Pamr1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_776110.3 Gene:Pamr1 / 210622 MGIID:2445082 Length:720 Species:Mus musculus


Alignment Length:288 Identity:74/288 - (25%)
Similarity:110/288 - (38%) Gaps:78/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEVHIPKLDGRIVGGQDTNITQYPHQISMRYR--------GNHR------CGGTIYRSNQIISAA 75
            |....||..|          |::|.|.:: ||        |.|:      |.|.:.....::.||
Mouse   450 ESTPSPKTQG----------TRWPWQAAI-YRRTSGVHDGGLHKGAWFLVCSGALVNERTVVVAA 503

  Fly    76 HCVN-----TLSGPENLTIVAG---------SSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDA 126
            |||.     |:....:|.:|.|         ..:|       |.|.|..||:||.|..:..|.|.
Mouse   504 HCVTELGKATIIKTADLKVVLGKFYRDDDRDEKSI-------QNLRVSAIILHPNYDPILLDTDI 561

  Fly   127 AILILDGDFEFNDAVQPIELAKER----PDHDTPVTVTGWGTTSE---GGTISDVLQEVSVNVVD 184
            |:|.|......:..||||.||..|    ...::.:||.||...::   .|..:|.|....|.|||
Mouse   562 AVLKLLDKARISTRVQPICLATTRDLSTSFQESHITVAGWNILADVRSPGFKNDTLHYGMVRVVD 626

  Fly   185 NSNCKNAYS-----IMLTSRMLCAGVN-GGGKDACQGDSGGPLVYNNT----------LLGIVSW 233
            ...|:..:.     :.:|..|.||..: ....|.|..::||....:..          |:|:|||
Mouse   627 PMLCEEQHEDHGIPVSVTDNMFCASKDPSTPSDICTAETGGIAALSFPGRASPEPRWHLVGLVSW 691

  Fly   234 G--TGCAREKYPGVYCSVPDVL---DWL 256
            .  ..|:.    |:..:...||   ||:
Mouse   692 SYDKTCSN----GLSTAFTKVLPFKDWI 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 68/275 (25%)
Tryp_SPc 36..259 CDD:238113 70/277 (25%)
Pamr1NP_776110.3 CUB 128..234 CDD:238001
EGF_CA 240..272 CDD:238011
CCP 280..342 CDD:153056
CCP <408..443 CDD:153056
Tryp_SPc 461..718 CDD:238113 69/267 (26%)
Tryp_SPc 461..715 CDD:214473 68/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.