DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and ELANE

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001963.1 Gene:ELANE / 1991 HGNCID:3309 Length:267 Species:Homo sapiens


Alignment Length:236 Identity:73/236 - (30%)
Similarity:109/236 - (46%) Gaps:14/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNI 96
            |...||||:......:|..:|::.||.|.||.|:...|.::||||||..:: ...:.:|.|:.|:
Human    26 LASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVN-VRAVRVVLGAHNL 89

  Fly    97 WFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKE--RPDHDTPVTV 159
             ....|.:::...:.|....|..:|...|..||.|:|....|..||..:|..:  |..:......
Human    90 -SRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLA 153

  Fly   160 TGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYN 224
            .|||.......|:.||||::|.|| .|.|:.:        .:|..|.|.....|.||||.|||.|
Human   154 MGWGLLGRNRGIASVLQELNVTVV-TSLCRRS--------NVCTLVRGRQAGVCFGDSGSPLVCN 209

  Fly   225 NTLLGIVSW-GTGCAREKYPGVYCSVPDVLDWLVETVADKE 264
            ..:.||.|: ..|||...||..:..|...::|:...:...|
Human   210 GLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 70/222 (32%)
Tryp_SPc 36..259 CDD:238113 71/225 (32%)
ELANENP_001963.1 Tryp_SPc 30..245 CDD:238113 71/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.