DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss8

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:254 Identity:85/254 - (33%)
Similarity:115/254 - (45%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAG------- 92
            ||.||......|:|.|:|:.|.|.|.|||::..:..::|||||.......|...:..|       
  Rat    44 RITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSF 108

  Fly    93 SSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIEL--AKERPDHDT 155
            |::|...|       |.:||.|..||...:..|.|::.|.....|:..::||.|  |.....:..
  Rat   109 SNDIVVHT-------VAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGL 166

  Fly   156 PVTVTGWGTTSEGGTISD--VLQEVSVNVVDNSNCKNAYSI--------MLTSRMLCAGVNGGGK 210
            ..||||||..:...::..  .||::.|.::....|...|:|        .:...|||||...|||
  Rat   167 HCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGK 231

  Fly   211 DACQGDSGGPLV-------YNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVAD 262
            |||||||||||.       |   |.||||||..|.....||||........|:...||:
  Rat   232 DACQGDSGGPLSCPIDGLWY---LAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVAE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/245 (33%)
Tryp_SPc 36..259 CDD:238113 82/248 (33%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 82/246 (33%)
Tryp_SPc 45..284 CDD:238113 82/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.