DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Gzmc

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_599159.1 Gene:Gzmc / 171290 RGDID:620019 Length:248 Species:Rattus norvegicus


Alignment Length:267 Identity:71/267 - (26%)
Similarity:117/267 - (43%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHR----CGGT 64
            ::::.|:|.:|.       |.||         |:||.:.:....|:.....:..::.    |||.
  Rat     5 LILLTLLLPLGA-------RAEE---------IIGGNEVSPHSRPYMAYFEFLNDNGKKTFCGGF 53

  Fly    65 IYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAIL 129
            :.|.|.:::||||..     .::|:..|:.||......||.:.|.....||.|.......|..:|
  Rat    54 LVRDNFVLTAAHCRG-----RSMTVTLGAHNIKAKEKTQQIIPVANATPHPAYNPDKRSNDIMLL 113

  Fly   130 ILDGDFEFNDAVQPIELAKERPDHDTPVTV---TGWGTTSEGGTISDVLQEVSVNVVDNSNCKNA 191
            .|....:...||:|:.|.: |..|..|..|   .|||..:..|...:.|:||.:.|..:..|::.
  Rat   114 KLVRSAKRTSAVRPLNLPR-RNAHVKPGDVCYMAGWGKITPQGEFPNTLREVELTVQKDRVCESQ 177

  Fly   192 YS-IMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWG--TGCAREKYPGVYCSVPDVL 253
            :. ..:.:..:|.|.:.....:.:.|||||||......||||:|  .|.|    |.|:..|...|
  Rat   178 FQRSYIKASEICVGDSKTKGASFEEDSGGPLVCKKAAAGIVSYGKTDGSA----PQVFTRVLSFL 238

  Fly   254 DWLVETV 260
            .|:.:|:
  Rat   239 SWIKKTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 63/229 (28%)
Tryp_SPc 36..259 CDD:238113 64/232 (28%)
GzmcNP_599159.1 Tryp_SPc 20..241 CDD:214473 64/239 (27%)
Tryp_SPc 21..244 CDD:238113 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.