DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Klk1b8

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_032483.1 Gene:Klk1b8 / 16624 MGIID:892018 Length:261 Species:Mus musculus


Alignment Length:271 Identity:78/271 - (28%)
Similarity:124/271 - (45%) Gaps:28/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYR 67
            |.|::||.|.:|...|          .|.|..|:|||.:......|.|:::.....|.|||.:..
Mouse     2 RFLILFLALSLGGIDA----------APPLQSRVVGGFNCEKNSQPWQVAVYDNKEHICGGVLLE 56

  Fly    68 SNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYR----TLNN-----D 123
            .|.:::||||.     .:...:..|.:.::......|...|.:...||.:.    ||..     |
Mouse    57 RNWVLTAAHCY-----VDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLTLKEIPPGAD 116

  Fly   124 Y--DAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGT-TSEGGTISDVLQEVSVNVVDN 185
            :  |..:|.|....:..|||:||.|..:.....:....:|||: |.......|.||.|.:.::..
Mouse   117 FSNDLMLLRLSKPADITDAVKPITLPTKESKLGSTCLASGWGSITPTKWQKPDDLQCVFLKLLPI 181

  Fly   186 SNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWG-TGCAREKYPGVYCSV 249
            .||...:::.:|..|||||...|||:.|:|||||||:.::.|.||.|.| ..|.:...|.:|.::
Mouse   182 KNCIENHNVKVTDVMLCAGEMSGGKNICKGDSGGPLICDSVLQGITSTGPIPCGKPGVPAMYTNL 246

  Fly   250 PDVLDWLVETV 260
            .....|:.:|:
Mouse   247 IKFNSWIKDTM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 67/232 (29%)
Tryp_SPc 36..259 CDD:238113 67/235 (29%)
Klk1b8NP_032483.1 Tryp_SPc 24..253 CDD:214473 67/233 (29%)
Tryp_SPc 25..256 CDD:238113 67/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.